PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G28940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 366aa    MW: 38964.9 Da    PI: 6.9054
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G28940.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ ++++ G+g +W + ++++g++R++k+c++rw++yl
  LPERR02G28940.1 14 KGPWSPEEDAKLKAYIEENGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.92e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eE+ ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  LPERR02G28940.1  69 GDFTEEEEHIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.093962IPR017930Myb domain
SuperFamilySSF466895.43E-2611109IPR009057Homeodomain-like
SMARTSM007173.7E-121364IPR001005SANT/Myb domain
PfamPF002498.3E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-241569IPR009057Homeodomain-like
CDDcd001673.57E-91662No hitNo description
PROSITE profilePS5129421.92463117IPR017930Myb domain
SMARTSM007172.9E-1067115IPR001005SANT/Myb domain
PfamPF002494.5E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2270117IPR009057Homeodomain-like
CDDcd001675.81E-771111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MGRAPCCDKA SVKKGPWSPE EDAKLKAYIE ENGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGD FTEEEEHIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLGK  120
RAPSRRAAAR ANQDPSAAAA ICNGAGATTA ATAAHALSSS ALERIQLHMR LQGLYNAFTT  180
TNAVAAAPPQ WPKLETLIPT RPLPAAPAIQ PTDAVVATTT VQPNPHHLIG QTLTAAAVTT  240
TSEAFQSDHQ LDPAANNYIP GCIDQRAKLG FCPSSTGDAA GVEMNSSSMA GVFAGYGIHD  300
ELYDFLYKCE SVGGLQDGII PSLPELQCPD GGAIVGADEK FSTWTSASCD YGGSGGAGDY  360
DLGYDQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624187.11e-171PREDICTED: uncharacterized protein LOC4330950
SwissprotQ9FKL21e-88MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A0D9VLY30.0A0A0D9VLY3_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g54520.11e-169(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.15e-81myb domain protein 36